SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011340961.1.20986 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011340961.1.20986
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.18e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0082
Further Details:      
 
Domain Number 2 Region: 227-295
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.99e-20
Family Ferredoxin domains from multidomain proteins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011340961.1.20986
Sequence length 310
Comment 2-oxoacid:ferredoxin oxidoreductase, gamma and ferredoxin subunit [Pelobacter carbinolicus]; AA=GCF_000012885.1; RF=representative genome; TAX=338963; STAX=19; NAME=Pelobacter carbinolicus DSM 2380; strain=DSM 2380; AL=Complete Genome; RT=Major
Sequence
MYRIRFHGRGGQGIKTASRILGTALFIEGFEVQDAPRYGAERRGAPIFAYVRADTIPIQE
RGVIHRPDLVVVADETLLAITPAQVLEGITAATVVLIYSGHPESWWREQFPHVGRIIVLS
PIAEHPGGIPAGAFCAGAAAALLGEVSEEALTQAVEEELAAHDPELVLSNKQAVMTAYAA
VANYHGQVQSGPPLTVNETQPPAWIDMSRDAVDIAAPVIHAGTTSCLVKTGLWRTRRPVI
DKEKCRRCLQCCAWCPEGGIRVGEDGFPVIDYEHCKGCLVCAAQCPFKAIKVIPESQAKE
EQDAQAADRK
Download sequence
Identical sequences Q3A570
338963.Pcar_1238 gi|404492849|ref|YP_006716955.1| WP_011340961.1.20986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]