SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011347125.1.55770 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011347125.1.55770
Domain Number 1 Region: 95-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.1e-71
Family D-glucarate dehydratase-like 0.00015
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.19e-31
Family Enolase N-terminal domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011347125.1.55770
Sequence length 382
Comment MULTISPECIES: D-galactonate dehydratase [Xanthomonas]; AA=GCF_001008805.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=329; AL=Scaffold; RT=Major
Sequence
MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAGYVVGKDPARI
NDLWQTLYRAGFYRGGAILMSAIAGIDQALWDIKGKTLGVPVYELLGGLVRDRMKTYRWV
GGDRPGAIIQQITDYRALGFDTFKFNGTEEMKLIDSARAVDAAVVKVAEIREAFGNSIDF
GIDFHGRVGAPMAKALLRELEPFKPLFVEEPVLAEQAEYYPRLAASTSIPLAAGERMFSR
FEFKNVLCAGGIGMVQPDLSHAGGITECVKIAAMAEAYDVGFAPHCPLGPIALAACLHVD
FVSHNAVLQEQSIGIHYNEGADLLDYVINKDDFHCVDGSIAALPKPGLGVEIDEEMLKRT
NENPPDWRNPVWRHSDGSIAEW
Download sequence
Identical sequences Q3BUN6
316273.XCV1796 gi|78047352|ref|YP_363527.1| WP_011347125.1.100156 WP_011347125.1.10442 WP_011347125.1.11230 WP_011347125.1.13735 WP_011347125.1.199 WP_011347125.1.21303 WP_011347125.1.21317 WP_011347125.1.2259 WP_011347125.1.23534 WP_011347125.1.27112 WP_011347125.1.29361 WP_011347125.1.3003 WP_011347125.1.37942 WP_011347125.1.39371 WP_011347125.1.43396 WP_011347125.1.44794 WP_011347125.1.46677 WP_011347125.1.49886 WP_011347125.1.55770 WP_011347125.1.60785 WP_011347125.1.64411 WP_011347125.1.66420 WP_011347125.1.67180 WP_011347125.1.67877 WP_011347125.1.75734 WP_011347125.1.772 WP_011347125.1.79359 WP_011347125.1.81489 WP_011347125.1.8544 WP_011347125.1.89212 WP_011347125.1.89360 WP_011347125.1.94946 WP_011347125.1.9928 WP_011347125.1.99285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]