SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011348488.1.67877 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011348488.1.67877
Domain Number 1 Region: 30-244
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-53
Family Voltage-gated potassium channels 0.00028
Further Details:      
 
Weak hits

Sequence:  WP_011348488.1.67877
Domain Number - Region: 247-273
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0289
Family Retrovirus zinc finger-like domains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011348488.1.67877
Sequence length 290
Comment ion transporter [Xanthomonas euvesicatoria]; AA=GCF_001691345.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=LMG 909; AL=Contig; RT=Major
Sequence
MRPFSDPQLTAATDDGWRRQWFDIIYRHDTRPSRNFDLMLVVAILASVVVIMIDSVPRIH
SHAADWLVPLEWAFTVIFTLEYALRLAVVRRPLHYALSVWGVIDLLSILPSYLSFFVPGA
QTLLVVRVLRILRLFRILKLTRYIEESGQLLDALWRSRRKVLVFLFTVLTITVIAGATMY
IIEGPQHGFTSIPTSMYWAIVTMATVGFGDLVPQTTLGRFVTSALILIGYSIIAVPTGIY
TAELASSLREGGHTGKRDARNCARCGLEGHAADARYCRQCAEPLPALGNG
Download sequence
Identical sequences Q3BPN7
gi|78049101|ref|YP_365276.1| WP_011348488.1.100156 WP_011348488.1.10442 WP_011348488.1.11230 WP_011348488.1.13735 WP_011348488.1.199 WP_011348488.1.21303 WP_011348488.1.21317 WP_011348488.1.2259 WP_011348488.1.23534 WP_011348488.1.27112 WP_011348488.1.29361 WP_011348488.1.3003 WP_011348488.1.331 WP_011348488.1.37942 WP_011348488.1.39371 WP_011348488.1.40690 WP_011348488.1.43396 WP_011348488.1.44794 WP_011348488.1.46449 WP_011348488.1.46677 WP_011348488.1.49886 WP_011348488.1.55770 WP_011348488.1.60785 WP_011348488.1.64411 WP_011348488.1.66420 WP_011348488.1.67180 WP_011348488.1.67877 WP_011348488.1.75734 WP_011348488.1.772 WP_011348488.1.79359 WP_011348488.1.81489 WP_011348488.1.8544 WP_011348488.1.89212 WP_011348488.1.89360 WP_011348488.1.94946 WP_011348488.1.99285 316273.XCV3545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]