SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011375292.1.42590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011375292.1.42590
Domain Number 1 Region: 10-225
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.62e-53
Family PP-loop ATPase 0.00014
Further Details:      
 
Domain Number 2 Region: 346-451
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000549
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011375292.1.42590
Sequence length 459
Comment tRNA(Ile)-lysidine synthetase [Lactobacillus sakei]; AA=GCF_000026065.1; RF=na; TAX=314315; STAX=1599; NAME=Lactobacillus sakei subsp. sakei 23K; strain=23K; AL=Complete Genome; RT=Major
Sequence
MLERAFQNEIRCHQFWPTGAKVIVATSTGVDSMVLLTLLQRLPTALKPQLIVAHVNHELR
TESVAEEAYLRQFCLENDLSLQVAHWPLQQHPQTGIEAAAREFRYQFFEHLMTAEKADYL
VTAHHGDDQLETLMMKFIRSGELHEMRGIQSQRPFADGTLIRPLLPFAKQDLRDYALANN
ITSFEDQTNYETTVLRNRVRHTLVPFLKQENGQILQNANRFSQQLTALLGQQAQLATTLL
PLLDLKVTDKVISGQLKAIKTLPTAQQTAIWQLIIKQHFPQISPLKETQLQQLKQLIQST
VKPQGQLALGQRILFTKIYDRFQIGETTIGEIAAKDEKIRILMLNKWCVLPNNEQIGIFE
INHLPRKLSGQQLIWLADEQWPIVAKPCQLTDAIMIDKTHHKTLKRLFIDLKVPQEKRLN
SWGIWSQETLIGHPEFRVSALFIHEQTGKIRYVLCYANE
Download sequence
Identical sequences Q38V78
314315.LSA1599 WP_011375292.1.13714 WP_011375292.1.42590 gi|81429211|ref|YP_396212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]