SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011376591.1.55884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011376591.1.55884
Domain Number 1 Region: 20-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.09e-27
Family FUR-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011376591.1.55884
Sequence length 144
Comment transcriptional repressor [Prochlorococcus marinus]; AA=GCF_000760015.1; RF=na; TAX=167547; STAX=1219; NAME=Prochlorococcus marinus str. MIT 9311; strain=MIT 9311; AL=Contig; RT=Major
Sequence
MIKNTGQKKISETMVTNSDITKRQEQLLEELNKCEDELTGQKLHRQLIERGKVMGLTTVY
RNLQVLIKHGLIRSRHLPTGEVLYTPVDRDIHHLTCVQCGETSKMEGCPVKDIHTPKTNP
KKFQLLFHTLEYFGLCQNCYQAQN
Download sequence
Identical sequences Q31AJ5
gi|78779424|ref|YP_397536.1| 74546.PMT9312_1041 WP_011376591.1.55884 WP_011376591.1.72917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]