SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011379594.1.10075 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011379594.1.10075
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.79e-31
Family Sfri0576-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011379594.1.10075
Sequence length 114
Comment STAS/SEC14 domain-containing protein [Nitrosospira multiformis]; AA=GCF_000196355.1; RF=representative genome; TAX=323848; STAX=1231; NAME=Nitrosospira multiformis ATCC 25196; strain=ATCC 25196; AL=Complete Genome; RT=Major
Sequence
MITIEETENLISIAVFGEFTLADYQEFEDKVLRKAGREGKVNVLFDWRDMLSYTIDVAWE
DIKFVREHGSEFNRIAIITENQWRAWAAWVSNLFVDADIRVFRDYAAAKTWLEG
Download sequence
Identical sequences A0A1H3VU68 Q2YCI1
372708 WP_011379594.1.10075 WP_011379594.1.92891 gi|82701366|ref|YP_410932.1| 323848.Nmul_A0232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]