SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011379594.1.92891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011379594.1.92891
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.79e-31
Family Sfri0576-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011379594.1.92891
Sequence length 114
Comment STAS/SEC14 domain-containing protein [Nitrosospira multiformis]; AA=GCF_900107715.1; RF=na; TAX=1231; STAX=1231; NAME=Nitrosospira multiformis; strain=Nl4; AL=Scaffold; RT=Major
Sequence
MITIEETENLISIAVFGEFTLADYQEFEDKVLRKAGREGKVNVLFDWRDMLSYTIDVAWE
DIKFVREHGSEFNRIAIITENQWRAWAAWVSNLFVDADIRVFRDYAAAKTWLEG
Download sequence
Identical sequences A0A1H3VU68 Q2YCI1
WP_011379594.1.10075 WP_011379594.1.92891 372708 323848.Nmul_A0232 gi|82701366|ref|YP_410932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]