SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011390531.1.3410 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011390531.1.3410
Domain Number 1 Region: 205-461
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.44e-57
Family Pyruvate oxidase and decarboxylase Pyr module 0.073
Further Details:      
 
Domain Number 2 Region: 12-227
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.27e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 476-578
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.63e-17
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011390531.1.3410
Sequence length 595
Comment 2-oxoglutarate synthase [Rhodospirillum rubrum]; AA=GCF_000225955.1; RF=na; TAX=1036743; STAX=1085; NAME=Rhodospirillum rubrum F11; strain=F11; AL=Complete Genome; RT=Major
Sequence
MMTVSRKAVSSVSIALTGSGGAGVMTAGQILLDAAARAGFYGLMAKSLGPQIRGGESAAL
LRLSTRPVETPDDVYDILLAVDWGNVERFSAELPLAPTSVILADPAQGVVPPVMRAADPI
VVDVALKELAAGVPGGRVNMVALGLLAALIGLPQDSLAQVLAETLEKKGPAALDSSLAAL
RAGAAAAEAIPGCVCLPAPPSAPARWLISGNEASAFGALKGGIRFVAAYPITPATEILEW
LAPELPKVGGCLVQAEDELASINMILGGSFGGVPALTATSGPGLALMTESLGLGVASETP
IVVCNVMRGGPSTGIPTKSEQVDLNIALYGLHGDAPHVVTAPNGIGDCAATTQWSVHLAE
AMQVPVIVLSDQAMGQSRAIIDKPATRASVAQRLTAPPRAKSDETPYARYGVTASGISPM
AVPGTPGCAYTADGLEHSPRGMPSTQASHHGEQLDKRLRKLTGFAYGDAWADIEGDGPTA
LITWGSVTAAAREAAARLAEDGIAVRLISLRLIAPALPEAFAQALAGVSRALIVEQNHGR
QFYRYLRSVYDLPADTITYNRPGPVVLRPHEIVSAVKSWGARVHPPASEQTGQGE
Download sequence
Identical sequences Q2RQS7
gi|83594053|ref|YP_427805.1| gi|386350806|ref|YP_006049054.1| WP_011390531.1.3410 YP_427805.1.57063 269796.Rru_A2721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]