SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011412591.1.27578 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011412591.1.27578
Domain Number 1 Region: 9-392
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.06e-104
Family Cystathionine synthase-like 0.000000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011412591.1.27578
Sequence length 406
Comment aminotransferase class V-fold PLP-dependent enzyme [Aster yellows witches'-broom phytoplasma]; AA=GCF_000012225.1; RF=representative genome; TAX=322098; STAX=229545; NAME=Aster yellows witches'-broom phytoplasma AYWB; AL=Complete Genome; RT=Major
Sequence
MQNNPFRCLFPIFKTNPKLVYFDNAATSLKPQKVIDELTRFYNTNGLNTKSFGVLTNQNT
LLINETRIKTANFINAKPEEIIFTKGTTDSLNILSQNLGETLQEGDEIITSELEHNSSVL
PWIKQAKLKKAKLIFVPLNEQNQITVENFAKVLTSKTKIVVLTHVSNLLGYETPIKEITT
LAHQKNILVILDAAQSSSHLPIDVKFLDVDFLAFSSHKLYGPFGIGILFGKNHLLEQLQP
TLFGGVSIKEFSLKHFLLNEVPNKFESGTPNISGILAFKKALEFVEEIGFENIQKHEKKI
YQNIMKELKQIPNITIYNPQNFSNIITFNFNQIHAHDAEVFLSQENIYVRTGRCCAFLAT
QKIKQTSIIRVSIGIHNNQEDVGILIKNLKKTQTFFSKFNINKSRH
Download sequence
Identical sequences Q2NJG6
gi|85057590|ref|YP_456506.1| 322098.AYWB_310 WP_011412591.1.27578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]