SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011417115.1.90099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011417115.1.90099
Domain Number 1 Region: 189-308,345-550
Classification Level Classification E-value
Superfamily TPR-like 1.59e-42
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011417115.1.90099
Sequence length 569
Comment hypothetical protein [Syntrophus aciditrophicus]; AA=GCF_000013405.1; RF=representative genome; TAX=56780; STAX=316277; NAME=Syntrophus aciditrophicus SB; strain=SB; AL=Complete Genome; RT=Major
Sequence
MDYEPFPGMSKPTSLKLPLKKVLKWTAMVMGTVMAIAAALAAILYLSGGRQRVTGAVSFY
VLGHKPALHYLDIEKNGKDYRLNQGDILELAVRDEFVIKQVRTDVLSDRNISVDVEFIGN
ENDFRKLLKGTELVQMVVAAGSSSDASGRPPLSPRVLVKYGSQIVGTISIKTKVTPQDWL
QQSGASENLSSRIEQLQKALALNPSDDNVRRVLAGLYQQAGLADKAVEHYQILLSSNPDD
VFILTELVKAYMGRRKYNEVIDNCRRIVALEPKNAAAFAHLGYAYGELGDWNRAIESYET
SLGIDEGNPPVRLRLREAYEKAKQHGAAKIDQSVLKPRTPDSGGLAGLAGLADLDFKERR
YGAAVKKYEQLARSSPPRPSIYANLGYAYTELKNYAESAKNYEKALKAGAKDPQIYYNLG
FAYEKLGREKDAIGAYEKYEKDKPSLQVTQTLAELYLSEKRYDQAIQAYRKLIRNNPKKA
AWYASLGYVYGRKNDINNEIENYRTALRYDPEDDETCYRLAEAYERKGMYEEAISAYSSA
YDLNPDLSQAARKIPRLKIKILEKKHQES
Download sequence
Identical sequences A0A1V4Y9T6 Q2LSM8
WP_011417115.1.90099 gi|85859052|ref|YP_461254.1| 56780.SYN_00951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]