SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011447853.1.85653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011447853.1.85653
Domain Number 1 Region: 59-185,216-232
Classification Level Classification E-value
Superfamily TPR-like 1.4e-18
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011447853.1.85653
Sequence length 266
Comment hypothetical protein [Methanospirillum hungatei]; AA=GCF_000013445.1; RF=representative genome; TAX=323259; STAX=2203; NAME=Methanospirillum hungatei JF-1; strain=JF-1; AL=Complete Genome; RT=Major
Sequence
MRLITIPIIILVVFIIFAVITPVLLLEGIENILPADVRQNTADIRQNIAHLLIDVSSLLG
RYDTCIDLYDYLIYRYPDVAEYYGKKAIYLHRIGKLEDTLTALDGAIARDPENIDYLLRK
ARITKALYRNDESNQTYHQIDQITPKTAINFAYAGDAALDQSRYIQALERYTNSLALNPL
DSLIWEKRGDVIFALLTIPTAGLSADERLRNQDLYTEGIQSYENAMRLKPDRVHEIKIKM
NKRSDIFVPKSIAELESRYTQYRYLG
Download sequence
Identical sequences Q2FMU8
WP_011447853.1.85653 gi|88602115|ref|YP_502293.1| 323259.Mhun_0822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]