SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011448057.1.85653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011448057.1.85653
Domain Number 1 Region: 14-149
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0000695
Family Tryptophan biosynthesis enzymes 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011448057.1.85653
Sequence length 834
Comment peptidase U32 [Methanospirillum hungatei]; AA=GCF_000013445.1; RF=representative genome; TAX=323259; STAX=2203; NAME=Methanospirillum hungatei JF-1; strain=JF-1; AL=Complete Genome; RT=Major
Sequence
MTIHLPLLLAPAGSPEALIAACAAGADAVYLGGREFGARQFASNFSDDELKDAVRYAHLR
GIEVYVTVNTLITEQEMERALSYLLFLFSIGVDAVLIQDIGLLSYARQFIPDLILHASTQ
MGVHNIPGARYAAKNGCRRVVLARELTGEEIEEISEALSEYTVDLEEFAHGALCYAYSGR
CLLSSLVGGRSGNRGMCAQPCRKQYRMMEGPLDQYGRVNAAREIGKSGYLLSTKDLSLYP
FLDKIVKLPIAALKIEGRMRSPAYVATVTSIYRKALDAIRTESFHPDPEDIADLSIAFSR
GFTSGYINGSDYSQVMGRDYPGNQGYYLGSVISSDNRKIRVKPVSDITLRQGDGLVFRNE
HFMEGLVLRDDPVFRDGFIELKAPFVPKAGVCCYITGRRELERKISALLAQPDERYAGSL
TISCSLLFSPEGIIFGNGVVYDRREHAYQFEFIGPDIVEPAKTRSLTPDQIRKQLMKTGG
TVFTFDDIKISGEEGWFAPVRVLNRLRREILEAAEDIIIQSHLPKPEIVYNIRNVIGDHV
SSDNNGNQKPAIERSNLIVLVSSIPDANTALNHGADRVYLDWQDFPDKMCGLSDHARKIG
IVVPGVIRQKDLALFLTHLKKFASFGIRHFLVDSVGIGEYILECNPDCSVSSYYGLPVTN
TASITSCDRYEFCTLSPELSEQEISDICQVYRKKTGPSIALCCQGLIEAAVTEDHICAYA
HKQKGTGLVLQDEKEYSFPVWCEQSGRSHIMNSSEHSLISEYPVLYQMGIRWFIIDARGR
GVTYSGEMTRLWRRRMMPDISEEEVHQLRDTIISMSWGGITRSGYRRGLCSVKP
Download sequence
Identical sequences Q2FPH8
WP_011448057.1.85653 gi|88602319|ref|YP_502497.1| 323259.Mhun_1028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]