SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011449463.1.85653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011449463.1.85653
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily GlnB-like 1.97e-37
Family Prokaryotic signal transducing protein 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011449463.1.85653
Sequence length 110
Comment nitrogen regulatory protein P-II [Methanospirillum hungatei]; AA=GCF_000013445.1; RF=representative genome; TAX=323259; STAX=2203; NAME=Methanospirillum hungatei JF-1; strain=JF-1; AL=Complete Genome; RT=Major
Sequence
MKLIKAIIKPERLDAVKKALEDAGYFGMTITEVQGRGEQKGISLQYRGGTIEVDLIPKIE
MEILVSADKVDHVIETIKKGAYTGKIGDGRIFVIPVDASIKIRTGEVITE
Download sequence
Identical sequences A0A1V5SM61 Q2FS32
2005168270 gi|88603746|ref|YP_503924.1| 323259.Mhun_2505 2005417155 WP_011449463.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]