SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011449969.1.85653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011449969.1.85653
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily SIS domain 7.28e-35
Family mono-SIS domain 0.0000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011449969.1.85653
Sequence length 194
Comment 6-phospho-3-hexuloisomerase [Methanospirillum hungatei]; AA=GCF_000013445.1; RF=representative genome; TAX=323259; STAX=2203; NAME=Methanospirillum hungatei JF-1; strain=JF-1; AL=Complete Genome; RT=Major
Sequence
MSMMISRIGEIAETLRQDQVDCFISALMSADRIFVIGAGRSGFVAKSFAMRLMHLGLTSY
VVGETVTPSFHKNDTLIAFSGSGKTKSVMEACETTRQIGGQICLITGTRVSPMAELADCV
VLLDTEEESCHVGPDHFDLRQLRGEHRSISAACTPLGTLFETTAMIFADSVISALIEMKH
CSIEEIMHRYTNMQ
Download sequence
Identical sequences Q2FSA6
WP_011449969.1.85653 323259.Mhun_3031 gi|88604259|ref|YP_504437.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]