SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011454919.1.50977 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011454919.1.50977
Domain Number 1 Region: 139-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.81e-123
Family Enolase 0.0000000191
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.71e-57
Family Enolase N-terminal domain-like 0.00000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011454919.1.50977
Sequence length 425
Comment enolase [Jannaschia sp. CCS1]; AA=GCF_000013565.1; RF=na; TAX=290400; STAX=290400; NAME=Jannaschia sp. CCS1; strain=CCS1; AL=Complete Genome; RT=Major
Sequence
MSVIIDIHAREILDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGAYEAVEKRDGDKARYK
GKGVLAAVEAVNGEIADTLVGFDATEQVAIDQTMCELDGTDNKGRLGANAILGVSLATAK
AAADFTAQPLYRYVGGTMAHVLPVPMMNIINGGEHADNPIDIQEFMIMPVSATSIAEAVR
MGSEVFHTLKSELSAAGLSTGIGDEGGFAPNLSSTRDALDFVLKSIEKAGYAPGDDMVLA
LDCAATEYYRDGKYELSGEGKSLTSDENVAYLAALVANYPIFSIEDGMGEDDWDGWIALT
EALGDKVQLVGDDLFVTNPARLKDGIDRKAANSLLVKVNQIGTLTETLAAVNMATRAGFT
SVMSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEQLEETANFAGR
SILRG
Download sequence
Identical sequences Q28RE8
290400.Jann_1797 WP_011454919.1.50977 gi|89054288|ref|YP_509739.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]