SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011455187.1.50977 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011455187.1.50977
Domain Number 1 Region: 5-126
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-24
Family Sfri0576-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011455187.1.50977
Sequence length 135
Comment STAS/SEC14 domain-containing protein [Jannaschia sp. CCS1]; AA=GCF_000013565.1; RF=na; TAX=290400; STAX=290400; NAME=Jannaschia sp. CCS1; strain=CCS1; AL=Complete Genome; RT=Major
Sequence
MSTQIYETIEQIPTTAPNVYAFRVTGHIDDDASEALAKFMLAAFDRHEEKVDMLLDLTAF
TGSDWDSMLDGDVIKSRFRSLSEVRRYAVIGAPDRAAKMIEFMDKIIPVEAKAFDANQKD
AAWAFVGASEASVSV
Download sequence
Identical sequences Q28QM9
372825 gi|89054557|ref|YP_510008.1| WP_011455187.1.50977 290400.Jann_2066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]