SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011480837.1.99167 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011480837.1.99167
Domain Number 1 Region: 83-149
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 6.93e-29
Family CO dehydrogenase ISP C-domain like 0.00077
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.65e-24
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011480837.1.99167
Sequence length 153
Comment (2Fe-2S)-binding protein [Methylobacillus flagellatus]; AA=GCF_000013705.1; RF=na; TAX=265072; STAX=405; NAME=Methylobacillus flagellatus KT; strain=KT; AL=Complete Genome; RT=Major
Sequence
MVTLDINGESRQLDVPNEMPLLWAIRDVAQLTGTKFGCGMALCGACTIHLDSEPVRACVT
PVSAAVGKKITTVEAVGEDKVGKAVQAAWLELGVAQCGYCQAGQIMSATALLRSTLHPTD
EDIDEAMSGNICRCGTYPRIRAAIKLAAKEGAK
Download sequence
Identical sequences Q1GY03
265072.Mfla_2620 gi|91776969|ref|YP_546725.1| WP_011480837.1.99167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]