SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011498992.1.71292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011498992.1.71292
Domain Number 1 Region: 195-452
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.56e-67
Family PFOR Pyr module 0.044
Further Details:      
 
Domain Number 2 Region: 7-218
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.37e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0057
Further Details:      
 
Domain Number 3 Region: 463-569
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.5e-20
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011498992.1.71292
Sequence length 574
Comment 2-oxoacid:ferredoxin oxidoreductase subunit alpha [Methanococcoides burtonii]; AA=GCF_000013725.1; RF=representative genome; TAX=259564; STAX=29291; NAME=Methanococcoides burtonii DSM 6242; strain=DSM 6242; AL=Complete Genome; RT=Major
Sequence
MNTDLVIKVGGAAGQGLQTIGVVLAKTFKKSGFNVFTTQFYLSRVRGGHNTYQVRISNEP
IRAMTEKVDILIALDEASINEHLKEISDGVVIVDTDVIKIEQMNESIFHVPMLKIAKDVC
GNKIYFNSVAIGAALGLMCFNFEYLESVLTATFQKKGDEIIENNIKAARAGYDHAKKNCP
SAFNFAVKEPLEKDGRMLIAGNDAVALGALAAGVQFLAAYPMTPSTGVMTYIAAKADEFN
VVVEQAEDEIAALNMILGASYAGVRAMTTTSGGGFCLMAEALGLAGMTETPAVIFLSQRP
GPATGLPTMTEQGDLQFVLTAAQGEFPRCILAPGTPDDCFYLTAKAFNIAEKFQIPVFVM
SDQYLADSLFTCKKFDTSKIEIERHMMADDELKGKNEYNRYELTPTGISPRAIPGQAGFT
VVVDSDEHNETGHLDQTIDNRILMNEKRMKKLKFLEKEMEAPQLYGNKKADITLIGWGST
YGPLMEVVDILTSEGHSVDHLHFTHVYPLPVDAIKDMMTDAGKIVCVENNATGQFARLFE
CETGLRIDENVLRSDGRPYTPEHIIRALEQKKVI
Download sequence
Identical sequences Q12XI7
gi|91772897|ref|YP_565589.1| WP_011498992.1.71292 259564.Mbur_0890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]