SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011509650.1.12189 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011509650.1.12189
Domain Number 1 Region: 461-563
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.16e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011509650.1.12189
Sequence length 583
Comment sodium-independent anion transporter [Nitrobacter hamburgensis]; AA=GCF_000013885.1; RF=representative genome; TAX=323097; STAX=912; NAME=Nitrobacter hamburgensis X14; strain=X14; AL=Complete Genome; RT=Major
Sequence
MSIADGRPHQIRKPTFAELFTPKLVTVLREGYRGADFRADVVAGLTVAIVALPLSMAIAI
ASGATPDRGLTTAIIGGFFVSLLGGSRFQVGGPAGAFIVLVALTVERHGIDGVILATAMA
GVLLIAAGLLRLGTYIKFIPYPVTVGFTAGIAVIIFASQIKDFLGITLAKEPSQLVPKLE
ALARAGDTVSMSAVAVSVIAVVIIAGLKRFRPAWPGMLIAIVVTAVAAWALSLPVETIGT
RFGGIPRELSWPAWPAFSLDKVQAVFPDAVAFALLASIESLLSAVVADGMTGRRHRSNCE
LMAQGVANVASALFGGLCVTGLIARTATNIRAGARGPVAGMLHSAFLLLFMLIAAPLASY
IPLAALAAVLAVVAWNMVEKHEFATLIRASRGDAVVLLATFLLTVFRGLTEGILVGFALG
AVLFIHRMAQITGIEANVPLAAEDRADDANGDRQPYDAAMVSDPDVVIYRITGAFFFGAA
SEVGSVLDAIMERQKAFVVDFAAVPFLDSTAANAISRVAAKARRQGVSFFITGASPVVRR
ALLTHGVRPPRATFRETIARAVADIKAARHAPPIAAIDAQPAP
Download sequence
Identical sequences Q1QP92
WP_011509650.1.12189 323097.Nham_1108 gi|92116686|ref|YP_576415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]