SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011524435.1.86553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011524435.1.86553
Domain Number 1 Region: 171-561
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.02e-97
Family beta-Lactamase/D-ala carboxypeptidase 0.000099
Further Details:      
 
Domain Number 2 Region: 53-216
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 6.02e-42
Family Penicillin binding protein dimerisation domain 0.0015
Further Details:      
 
Domain Number 3 Region: 673-725
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000641
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011524435.1.86553
Sequence length 729
Comment peptidoglycan glycosyltransferase [Candidatus Koribacter versatilis]; AA=GCF_000014005.1; RF=na; TAX=204669; STAX=658062; NAME=Candidatus Koribacter versatilis Ellin345; strain=Ellin345; AL=Complete Genome; RT=Major
Sequence
MAKQAGPRDAKKRLYVLGGLLFLWACVVCMRLVQLQVFKYGEYVQKAARQQQRTINVDPP
RGVVYDRNGRELAMSVQVDSIFAVPSEIPDQPSTAHLLAKVLDLDSDDVLNHLKASRSFA
WIARKVDQDKSDRIRALNLRGVYFQKEAKRYYPKRELAAQVLGYVGLDDNGLAGTELQFD
DDLKGIPGRMMITMDARRKWFGRVEKQPEPGANVVLTIDQNIQYIAEKELDQAMQDTHAV
AGTVVVQNPRTGEILALANRPTFNPNVTKEITPADLKNHAVSDVYEPGSVFKTVTYSSAI
EEHLTNPDEVISCDPGFIVVGGIRIHDSHHVGVVPVSKAYAESSDVGAVKMGLRLGPDKF
YKHIKEYGFGQQTGIELPGETRGLIKPPARWSGSSIGSMSIGQEVGVTPLQVISMVSSIA
NDGIYTPPRIVADVTPPTSGYRQIVFHPKEQRRVISSMTAAQMRSMMQSVVLEGTARRAI
LNGYTAAGKTGTAQKVDPKTHLYSKTDYVGSFVGFAPVNSPALTIAVILDSARGLHQGGQ
VSAPVFNRIMQQSLEYLNVPHDTEIKGDPKRQLLLAKVKDSDLEEGGALDREGPGMDFSE
ADASNASKPDTKTVVAKEAKPSAANMGATIMPTALAAAPVTSGGMLPAPVSNATPQPAQE
NAPGGPMTVDVEGVVVPSLLGKSVRGVIEAAQQQGFEVSVIGSGVARGQTPAPGTRLAPG
ERVTVRFSR
Download sequence
Identical sequences Q1IKG4
204669.Acid345_3635 WP_011524435.1.86553 gi|94970662|ref|YP_592710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]