SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011525029.1.86553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011525029.1.86553
Domain Number - Region: 34-93
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00127
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011525029.1.86553
Sequence length 252
Comment protein PASTA domain-containing protein [Candidatus Koribacter versatilis]; AA=GCF_000014005.1; RF=na; TAX=204669; STAX=658062; NAME=Candidatus Koribacter versatilis Ellin345; strain=Ellin345; AL=Complete Genome; RT=Major
Sequence
MRKFFSFVLRLLVLVVVFLVSMLTAMRFAIHTREVPIPKLVGMTPQQAQQTLTGLGLTLV
RENRYFSADVPEGKILSQMPPVGEKVRRGWRVRVAESMGPQRAIIPALLGDSQRAAELNI
RRRGLDLGTVAFINLPDSEPETVVAQDPPPNATGVTSPKISLLVAAPATPEAFVMPDFVG
QPLDSVVKTINDAGFKVGNIHTITPATPTATVAAPAPTPVPMSRSVATVVRQSPSPGQRI
TTDVAINVDVTR
Download sequence
Identical sequences Q1IIS0
gi|94971256|ref|YP_593304.1| WP_011525029.1.86553 204669.Acid345_4230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]