SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011526199.1.40060 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011526199.1.40060
Domain Number 1 Region: 222-339
Classification Level Classification E-value
Superfamily TPR-like 3.5e-17
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011526199.1.40060
Sequence length 359
Comment hypothetical protein [Lawsonia intracellularis]; AA=GCF_000055945.1; RF=representative genome; TAX=363253; STAX=29546; NAME=Lawsonia intracellularis PHE/MN1-00; strain=PHE/MN1-00; AL=Complete Genome; RT=Major
Sequence
MNEVSVGIEDGDSIACQKQWGYFSIITYILLFFLIFSPSITIAKEPILEVTYTIPYHAHL
VTEPVIQIAEAATKLHALEQTRSNFTSNLAVKLELRTREQQLALASAIYFVSIHERTVLD
GPKLSIKAHVYPSSEKILDDHIRQLLRQQDHLQLRLLAVNQLEQYINEGVELLNQAHLCS
SADIRCKHDDSLVPKIKRTSNRIKALELFLVELNDFEHVWANPEKSVLTFSEATALDPDN
SLLWLGVGECLVLLNRPYESIKAFQKVMIKNNIPARTLYMRGIAHLQMYLPGLAIKDISQ
ALQLEPEHPSWWRALGTAKLVAGDTVAMCADFYQACAMGDCEGLAEVREQNFCLVSPEF
Download sequence
Identical sequences A0A1S8C0R5 Q1MS53
gi|94986561|ref|YP_594494.1| 363253.LI0116 gi|442555375|ref|YP_007365200.1| WP_011526199.1.40060 WP_011526199.1.91582 WP_011526199.1.98040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]