SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011526461.1.40060 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011526461.1.40060
Domain Number 1 Region: 269-420
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 2.88e-47
Family Peptidoglycan hydrolase LytM 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011526461.1.40060
Sequence length 437
Comment peptidase M24 [Lawsonia intracellularis]; AA=GCF_000055945.1; RF=representative genome; TAX=363253; STAX=29546; NAME=Lawsonia intracellularis PHE/MN1-00; strain=PHE/MN1-00; AL=Complete Genome; RT=Major
Sequence
MSKTKLLVITIGIASIILAAATYIFFKNTDPPIISMIQPTQYISPRQPLTLTITSKYSPL
KLIQIIVKQNEYTKTLINQPIINGHLIETVDIDFKKSGLQDGPFELIVKAQDSSYSNFGK
GNISNKTWDMNFDSQPPQITIHSPTPSLHKGSATAIAFTVSKPVAVIGVQLEEKFFPAFQ
QANGTYYCFFPFPIEFSPKTFNPKLFAQDLAGNKSYISVHVHSLERSFKIDTLTITDTFL
DKKMPNFEQNFPDTQTQVERYIKVNSILRIENEKKLIEISKKTSPMMLWSGKFHTLPRAA
VKATFGENRTYMYQNQKIDQQFHMGLDLASTANAPIPAANDGIVVYTGDLGIYGNIVIID
HGLGLQTLYSHLSKITAKEGDVVKKGDLIGYTGMTGLAGGDHLHFGFLVGGIQVNPIDWL
DPKWIKNTIITRLNNNV
Download sequence
Identical sequences Q1MRE4
gi|442555651|ref|YP_007365476.1| WP_011526461.1.40060 WP_011526461.1.98040 gi|94986820|ref|YP_594753.1| 363253.LI0376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]