SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011527181.1.98040 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011527181.1.98040
Domain Number 1 Region: 247-575
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.19e-81
Family beta-Lactamase/D-ala carboxypeptidase 0.00011
Further Details:      
 
Domain Number 2 Region: 82-229
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.57e-40
Family Penicillin binding protein dimerisation domain 0.002
Further Details:      
 
Domain Number 3 Region: 630-679
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011527181.1.98040
Sequence length 693
Comment penicillin-binding protein [Lawsonia intracellularis]; AA=GCF_000331715.1; RF=na; TAX=1234378; STAX=29546; NAME=Lawsonia intracellularis N343; strain=N343; AL=Complete Genome; RT=Major
Sequence
MSYLGLSHRQNKYHKFTWTTSRKKVRGKYFSFRIDKWNAFRFQIVAILFCIVWCGLWCRS
AYIQLWKGTFFSEKARRQHIALETVSTPRGNIVDRNGRILAKSIQCYSVYADPFSIKDIE
STAIKLSNCLHLSEETIRKLLQKQNRFVWISRHIDDATAIAINQMKIPGVMLLKEYERVY
PYKHVAGQLLGFVGVDGNGLEGLEHSFNDYLSSFSTKQLVMRDASGRRFYINNGEELHNS
TRELQLTIDLQIQSIAEDAIAQAVSEVGAKWGGVLIVDVKSSEILAWSQYPFFNPNAYRQ
YKPSEYRNRLALDAFEPGSTFKPFLIAAALQEGIVTKDTLFNCEGGVWKIKNVVIRDDGT
PQKELSVTKILSHSSNIGCGKISLELGSQKFYYYLTKLGFGQPTGLNIIENKGILRRPRE
WSEADLISTAFGQSLSTNALQLTQGFLTIATHGIYKPISLFKTPLKKVSEQRIFSEDISS
EVLTMMRQVVESGTGKRAAISGVSIAGKTGTAQKVDKTGKYGQERIASFVGLFPAEDPHY
LIMVVIDEPITKKYGGVIAAPVFRKIATKVMAYVGSPESLQYQVVTKEEEKISSNKVSSL
VRTNKKEKSCSNTLEVRQKIDRKDPIEYATSLKIPDVVGKSIRKAIELFAGQGLVPEVKG
NGIVVIKQEPEAGTHLIKQHLLDKKCILWVSEK
Download sequence
Identical sequences A0A1S8BR71 Q1MPC5
WP_011527181.1.40060 WP_011527181.1.91582 WP_011527181.1.98040 363253.LI1098 gi|442556394|ref|YP_007366219.1| gi|94987540|ref|YP_595473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]