SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011529308.1.71355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011529308.1.71355
Domain Number 1 Region: 62-154
Classification Level Classification E-value
Superfamily VPA0735-like 0.0000327
Family VPA0735-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011529308.1.71355
Sequence length 165
Comment hypothetical protein [Deinococcus geothermalis]; AA=GCF_000196275.1; RF=representative genome; TAX=319795; STAX=68909; NAME=Deinococcus geothermalis DSM 11300; strain=DSM 11300; AL=Complete Genome; RT=Major
Sequence
MKRRLLPALLPLALAACSQKGIEGLKTFDYSGGDERSGSLVYAETPPVGGPHNALWQTCG
VYDRPLYNEYAVHSLAHGAVWITYRPDLGPEGVAALRQLLNGYPATLLSPYPGLPAPVVV
SAWNAQLAVDAPDDRRLKAFLDRYGQGETAPERGAPCSGGYGGTR
Download sequence
Identical sequences Q1J223
319795.Dgeo_0158 WP_011529308.1.71355 gi|94984266|ref|YP_603630.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]