SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011530735.1.71355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011530735.1.71355
Domain Number 1 Region: 44-138
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000000458
Family Multidrug resistance efflux transporter EmrE 0.0054
Further Details:      
 
Domain Number 2 Region: 195-289
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000327
Family Multidrug resistance efflux transporter EmrE 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011530735.1.71355
Sequence length 298
Comment EamA family transporter [Deinococcus geothermalis]; AA=GCF_000196275.1; RF=representative genome; TAX=319795; STAX=68909; NAME=Deinococcus geothermalis DSM 11300; strain=DSM 11300; AL=Complete Genome; RT=Major
Sequence
MPSAALPARSLLLALLITLIWGVNFVVIKWSVAGASPLLVAALRFAVAAFPAVLFVRRPQ
VPARILWGYGLSVGVVQFGLLYLAVQLGMSAGVASLLMQTQAFFTALLAARFLGERITPP
QMLGMTLAFGGMALIGLAAGGDVTLLGLALTLVAALGWAISNLLVRASGGANVFALVIWS
SLIAPLPLTLLAGLTSGWGAVAHTLTASGPAFWAAVLFMGLGNTVLGFGVWSLLIQKHGA
ARVAPLSLLVPVFGMLASAVFYHEGFPPLKLLGAGLVFGGLVLHVLGGRLRLVLSPAD
Download sequence
Identical sequences Q1IXY3
WP_011530735.1.71355 319795.Dgeo_1606 gi|94985706|ref|YP_605070.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]