SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011531077.1.71355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011531077.1.71355
Domain Number 1 Region: 7-105
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000327
Family Multidrug resistance efflux transporter EmrE 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011531077.1.71355
Sequence length 111
Comment LuxR family transcriptional regulator [Deinococcus geothermalis]; AA=GCF_000196275.1; RF=representative genome; TAX=319795; STAX=68909; NAME=Deinococcus geothermalis DSM 11300; strain=DSM 11300; AL=Complete Genome; RT=Major
Sequence
MRAWIALFSAIACEVTGTLALKLLGLHTPWLALAVTGSLIVLSYLLLSLVFRRIPVAVAF
AVWEAVGLAAVTLLSVWLLGDHLTQLQLLALGGLLLGARLLHGGTRARGEA
Download sequence
Identical sequences Q1IWY4
gi|94986055|ref|YP_605419.1| WP_011531077.1.71355 319795.Dgeo_1956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]