SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011557778.1.37251 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011557778.1.37251
Domain Number 1 Region: 12-102
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000432
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011557778.1.37251
Sequence length 110
Comment MULTISPECIES: anti-sigma factor antagonist [Mycobacterium]; AA=GCF_001667465.1; RF=na; TAX=1834086; STAX=1834086; NAME=Mycobacterium sp. 852002-10379_SCH5584320; strain=852002-10379_SCH5584320; AL=Contig; RT=Major
Sequence
MATPLTVNADRHTDGTPLLVAAGEIDLSNVETFTRALITVIAAADGAGGTVTVDLSAVEY
LDSAAIGALSVHADQVPQMRLVANPYLIPVLRISGIDQLATVEPAQPTDG
Download sequence
Identical sequences A0A1A0UDY1 A0A1X0GDS9 A1U9S0
gi|108797331|ref|YP_637528.1| 164756.Mmcs_0351 164757.Mjls_0340 189918.Mkms_0361 WP_011557778.1.20321 WP_011557778.1.3374 WP_011557778.1.37251 WP_011557778.1.44017 WP_011557778.1.47369 WP_011557778.1.73225 gi|126432953|ref|YP_001068644.1| gi|119866416|ref|YP_936368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]