SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011572651.1.31310 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011572651.1.31310
Domain Number 1 Region: 1530-1648,2032-2069
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.61e-24
Family Intein (protein splicing domain) 0.024
Further Details:      
 
Domain Number 2 Region: 967-1093,1458-1491
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.51e-21
Family Intein (protein splicing domain) 0.083
Further Details:      
 
Domain Number 3 Region: 1309-1376
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000108
Family Intein endonuclease 0.021
Further Details:      
 
Domain Number 4 Region: 1840-1928
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000232
Family Intein endonuclease 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011572651.1.31310
Sequence length 2289
Comment DNA polymerase II large subunit [Haloquadratum walsbyi]; AA=GCF_000009185.1; RF=na; TAX=362976; STAX=293091; NAME=Haloquadratum walsbyi DSM 16790; strain=DSM 16790 = HBSQ001; AL=Complete Genome; RT=Major
Sequence
MRDADKQYFETLESHLEQAFARARQAKGQGYDPKPEVEIPVARDMADRVENILAIPDVAE
RIRELDDERSREEVALELVTDFVEGTVGDYDTREGKIEGAVRTAVALLTEGVVAAPIEGI
DRVEILSDDDGSEFVNVYYAGPIRSAGGTAQALSVLVADYARSLLDIDEYSARTDETERY
AEEVSLYDRETGLQYSPKDKETKFITKHMPIMLDGEATGNEEVSGYRDLERVDTNAARGG
MCLVLAEGIALKAPKIQRYTRQLAEVEWPWLQDLIDDTIGSDEHSNNSVKNGEADIVKTD
KDTNESETEDGIDNDDYNDSGLEPANSPRADATNKYLRDLIAGRPVFGHPSAAGAFRLRY
GRARNHGFATAGVHPATMHIVDDFIATGTQLKTERPGKAGGVVPVDSIKGPTVRLANGDV
RCINDPEEAEKLQNGVEKILDLGEYLVNFGEFIENNHPLAPAAYVFEWWIQEFEASNADV
QALRDDPTVDLESPTFENAMRWAKKHDIPLHPAYTYLWHDISVTEFDHLADAVAAGEITM
NEVSDTNSASGNTSLRANTNTDDTLTIDTTPAIRETMERLLIEHHQDSDSIHIPAWRALA
LSLGIKIESDNDTGIGDRMWSLTDLSKHARKQDDGKSAIAAVNEVAPFQVRERAPTRIGS
RMGRPEKSEDRDLSPAVHTLFPIGEAGGNQRNLSDAAQSFGDNTERGQISVQLGKRRCPY
CETVGFELQCAECGRHTEPQFVCRECESVLSPDESGRVHCDRCERDVTSAEWQDIDLHQR
YRDALDRVDERESSFEILKGVKGLTSSNKTPEPLEKGILRAKHGVSSFKDGTVRYDMTDL
PVTAVRPKELDVTAAHFRELGYQTDINGNPLQFDDQLVELKVQDIVLPDGAAEHMMKTAD
FVDDLLEQFYELNQFYQIDERDDLIGELVFGMAPHTSAAVVGRIVGFTSAAVGYAHPYFH
AAKRRNCFHPETKIWFRDTDNEWHHETIQTFVEDRLDDPEIDAVGTLVQEVDDNTDREIS
VPSIDDNGNERLQSVTAVSKHRAPNHLVQIETISGREITITPDHEMHIFEQGNLVSKQAS
KITSGEYAVIPKRLQTISPSSHTPQHDLLREFLTRDELTADRLIIHTSDPVRLCNRVFPE
EVTSCKDAVEIMQNTACHLDKNKETLIGWLGEGRIPVALLRGFVETDEALLMSIPDDVQI
GLRGEKVRIDRHIGFTEELTSLLGYYAAAGIVHTQTNPISYESAQQEQSRITFYNIDTQT
QTDLLNALNSVFEIEPIQYNLDGEILGVPGELIRRVFDTVFDVGTQPSHKRIPQALFDAS
ESHITSYLRCFFSTHDSLTTDTRDISATTVSREFKEDIIAALRRLGITAEVTTQQSRSVP
EVLPDWYAIDDITHHDADNSLNLTRSYVISIASSDAVTLQRDRQAQEQIKYDAQGLIANN
NAIHQSRQVTDGGRKDYITEPITDIEYVDADIDYTYCLTVSETHSLIVNDLSQKQCDGDE
DCVMLLMDGLLNFSREYLPDKRGGSVAADSRLVAVSPDDKIVFTTIEDFWKKLNTPIERN
GKFRKRTCVSEGWQTYAFDENHEASLRPIEKAIRYTADESEQLRRITTQLGRSLDITDEH
SLFRYDDGIEEVAGDDLTAGDIIVAPRTLDVEVTQTTLDLSEYIHDNERCPSEQTGSGEL
NLASKSAISDSRNKETPGVTHNILPQRSKFTDEMTTLSPTAVGGLESEQNETLRVGESTG
AIERYINVDDSFGWLLGQFIAQRSISTDALTMTVHTAAEKHAERIVATSDSVFGIKPTVN
SIERGYEIVFPSVFDTIVSGLTAKEQSEPEQDVDHTHTDEIGIPECILHAPDDIVLSFLQ
GFILAENAQRKGNAASEASEMVSESETTVTLETPSVGVKDGLVFLCHRLGVITDISEKSG
EEYSVHFEESRYTVSIATEGKTNPLDQILNGERPTMPEGVSVPVPDALLTIHESIANSPH
IDQVIPDTVVQQETVSLETLQSLLTGLSTVDLPAQLEAKRDELTLLTEGDLSYLRVESVE
CVDYDGYLYDLQVGGEPVFTANWLYAHNSMDAPLVMSSRIDPSEIDDEAHNMDIVRQYPR
EFYEATRRMEDPDEWEEEVTIAEEYLDTDNEYTGFNHTHDTTDIAAGPDLSAYKTLDSMM
DKMDAQLELARKLRAVDETDVAERVIEYHFLPDLIGNLRAFSRQQTRCLDCGESYRRMPL
TGECRECGGRVNLTVHEGSVNKYMDTAIHIAEEFDCREYTKQRLEVLERSLESIFEDDTN
KQSGIADFM
Download sequence
Identical sequences Q18ER3
WP_011572651.1.31310 362976.HQ3461A gi|110669331|ref|YP_659142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]