SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011585296.1.79486 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011585296.1.79486
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.33e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011585296.1.79486
Sequence length 127
Comment anti-sigma factor antagonist [Cytophaga hutchinsonii]; AA=GCF_000014145.1; RF=representative genome; TAX=269798; STAX=985; NAME=Cytophaga hutchinsonii ATCC 33406; strain=ATCC 33406; AL=Complete Genome; RT=Major
Sequence
MKYTVEKTEKYVLFQLHEEKLTSITAPDLKTELVTLNAEGFNNIILNMTDVKYADSSGLS
SILIGNRVCNNSGGLFVMCNVNDHVMKLLKISQLDTILTLLPTVEEGIDAVFLHEIQGDL
EDEESAE
Download sequence
Identical sequences Q11TT5
WP_011585296.1.19587 WP_011585296.1.79486 gi|110638312|ref|YP_678521.1| 269798.CHU_1913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]