SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011585956.1.79486 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011585956.1.79486
Domain Number 1 Region: 60-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 7.85e-22
Family Ribosomal protein L9 C-domain 0.00059
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000000000296
Family Ribosomal protein L9 N-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011585956.1.79486
Sequence length 147
Comment 50S ribosomal protein L9 [Cytophaga hutchinsonii]; AA=GCF_000014145.1; RF=representative genome; TAX=269798; STAX=985; NAME=Cytophaga hutchinsonii ATCC 33406; strain=ATCC 33406; AL=Complete Genome; RT=Major
Sequence
MEVILKEDIKGLGYKNDLVQVKAGYGNNFLIPRGYAINATVSAKKVVAENIKQAAHKAEK
LKKDAVATSEKIAGLALEIAAKVGDTGKIFGAVTSLQISDALAKKGISVDRKKIAFKGDV
KDAGEHTALIDLHKEVKVELKFTVVAE
Download sequence
Identical sequences Q11RW8
WP_011585956.1.19587 WP_011585956.1.79486 gi|110638979|ref|YP_679188.1| 269798.CHU_2593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]