SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011589257.1.66393 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011589257.1.66393
Domain Number 1 Region: 16-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 3.79e-80
Family Acetamidase/Formamidase-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011589257.1.66393
Sequence length 409
Comment MULTISPECIES: formamidase [Alcanivorax]; AA=GCF_000524665.1; RF=na; TAX=1435973; STAX=1435973; NAME=Alcanivorax sp. 97CO-5; strain=97CO-5; AL=Scaffold; RT=Major
Sequence
MAETIIKIDLKQSPYENENVHNRWHPDIPMAKMVKPGDDFILECHDWTGGQIENNDSADD
VRDVDLTQVHFLTGPVGVEGAEPGDLLVVDILDIGTFDESQWGFNGFFSKQNGGGFLTEH
FPEAQKSIWDFNGMFTKSRHIPNVEFAGLIHPGLIGCLPSKEMLEEWNTREKALYDTEPD
RVPGLANLPYADTAHMGKLSGDAKAQAAAEGARTVPPREHGGNCDIKDLSRGSQVYFPVY
VKDAGLSVGDLHFSQGDGEITFCGAIEMAGWIHLRVNIIKGGMEKYGIKNPIFKPSPMAP
KYDDYLIFEGISVDEQGKQHYLDVHVAYRQACLNAIEYLKKFGYTGAQAYALLGCAPVQG
HISGVVDVPNACATLWLPTDIFDFDIKPGMDGPQHSVAGSVDIPLSKDK
Download sequence
Identical sequences Q0VN22
393595.ABO_1978 gi|110834839|ref|YP_693698.1| WP_011589257.1.14994 WP_011589257.1.41240 WP_011589257.1.66393 WP_011589257.1.75482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]