SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011590065.1.50147 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011590065.1.50147
Domain Number 1 Region: 167-330
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.93e-28
Family Histidine kinase 0.01
Further Details:      
 
Weak hits

Sequence:  WP_011590065.1.50147
Domain Number - Region: 106-173
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00051
Family Homodimeric domain of signal transducing histidine kinase 0.0055
Further Details:      
 
Domain Number - Region: 19-73,205-230
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0628
Family Calcium ATPase, transmembrane domain M 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011590065.1.50147
Sequence length 337
Comment sensor histidine kinase [Clostridium perfringens]; AA=GCF_000013285.1; RF=representative genome; TAX=195103; STAX=1502; NAME=Clostridium perfringens ATCC 13124; strain=ATCC 13124; AL=Complete Genome; RT=Major
Sequence
MNLRDFIKERIVFIIINSLILLFTALLLMVLKVDSFAILFIVIINEAGILIYHIFDYLRK
KQYYNEIKENMESLDKKYLISEVIEEGTFTESKLIYDVICKGNKAMNDEIGEFKRGINDY
REYIELWVHEIKTPIATCKLLIENNESPLTESIGEEVCKLENYIDQALFYTRSNTLEKDY
IIKEMSLSSCVNKVLNNNADSLIKKRVKISLGDLEKQVYSDSKWIEFILGQIISNSIKYM
NKEHKELKIYCNENSKYVILNIEDNGAGISEKDISRVFDKGFTGENGRKFGKSTGIGLYL
CKKLCKKLGLDIKLISEEGKFTRVSIIFPINRMMIFE
Download sequence
Identical sequences A0A0H2YUG0
WP_011590065.1.50147 gi|110801065|ref|YP_694580.1| IDP04382 195103.CPF_0116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]