SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011590207.1.50147 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011590207.1.50147
Domain Number 1 Region: 66-186
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 8.12e-21
Family Galactoside acetyltransferase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011590207.1.50147
Sequence length 199
Comment hexapeptide repeat-containing transferase [Clostridium perfringens]; AA=GCF_000013285.1; RF=representative genome; TAX=195103; STAX=1502; NAME=Clostridium perfringens ATCC 13124; strain=ATCC 13124; AL=Complete Genome; RT=Major
Sequence
MKIFKLSILKTIWYSIKFKSKILVGKRCKIYLKKGSKIIVKNGVLRIGIEHNTLVHTILE
INESGILNIDGNVSIGKGCKVVIANRAKLEINNDSYINECSKIVCLKNIHIGKKCAISWG
VNILDTDYHYLIKKGIKNVKEKNIYIDNHVWIGCNSTILKGSFIGENTVISANSLVNSKI
KKNGLFINGVFKEGYNWSK
Download sequence
Identical sequences A0A0H2YRM2
195103.CPF_0470 gi|110799432|ref|YP_694925.1| WP_011590207.1.50147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]