SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011590299.1.50147 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011590299.1.50147
Domain Number 1 Region: 8-404
Classification Level Classification E-value
Superfamily Clc chloride channel 1.1e-41
Family Clc chloride channel 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011590299.1.50147
Sequence length 418
Comment chloride channel protein [Clostridium perfringens]; AA=GCF_000013285.1; RF=representative genome; TAX=195103; STAX=1502; NAME=Clostridium perfringens ATCC 13124; strain=ATCC 13124; AL=Complete Genome; RT=Major
Sequence
MKKYFSLGILILYGIVLGGIVGAVSWLFLYVVSSGIHFMWNELPGKFNLPYWTILVCSIG
GILVGLCQKYLGEYPKLMPEVMAEFKETKRVDYKNVPKACVSALITLFFGASLGPEAALV
NIIGGLSTLVGDFLKWIVKDKELEKYDSLVTEFSMEATIGLIFHAPLIGLTPLIEDDDSS
VRKNIKTIVYSITTAAGFGVLILLSQIDNRPSFIVHFGSFNLGMSEIISIISLIICGILM
ALLYGGYGKILHKIFLPLKNYKIIRALIGGIILGIVGTWLPYTLFSGEHEVKVLVKEWSS
LSIRILILISLVKLFLTEVCLSTGWRGGHIFPVVFSGVSMGYALSAIFSIDPVVTVTIVT
TAFTSSVLRNAVVTLLLLVLFFPSSLIWIMLIAAFLSAYVLKRWDSRGNKEESVKKVI
Download sequence
Identical sequences A0A0H2YQB9
WP_011590299.1.50147 gi|110799384|ref|YP_695114.1| 195103.CPF_0661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]