SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011590627.1.30163 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011590627.1.30163
Domain Number 1 Region: 421-589
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.56e-39
Family Histidine kinase 0.00084
Further Details:      
 
Domain Number 2 Region: 348-432
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000726
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 
Domain Number 3 Region: 101-225
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000011
Family PYP-like 0.056
Further Details:      
 
Domain Number 4 Region: 251-350
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000489
Family Heme-binding PAS domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011590627.1.30163
Sequence length 623
Comment PAS domain-containing sensor histidine kinase [Clostridium perfringens]; AA=GCF_001579765.1; RF=na; TAX=1502; STAX=1502; NAME=Clostridium perfringens; strain=JP55; AL=Complete Genome; RT=Major
Sequence
MKDFNFEEILESCPMDYIYGKLKNKDSSDLFVLKSSIKEFNSKLLSEVLGSDIDFKTIFS
KSNIHGEGYYKDLNENFSLKLLNNDYVIIWFSQYLLEKYNKLEINLKKEKDMLDLFLDSL
TDYVFFKDIDGRYINCNKAFENKVGIEKKYIIGKTDKDIFFDDPSKVETFIKTDREVINS
REKKVYGEEWGFECEDGYLEETVKSPYFDENNEVKGIIGLTRDISYKKAIEYRLKKNDKM
FFEVFNYLDDVVIIKEGEKTIYVNHAFEKLYGLNCKELYKEKSMIVKLDRIHPEDRYKFS
NIDFGNFFMEKARIVRADNEVRNVLFRANSIKNENGESIRRIIVINDITDTIEKSNEMEK
LRVEFFANISHEFKTPVNLIYSALQLLELKLKNNIDRNEESYINYIKMAKQNVFRLLKLI
NNLIDSTKLEAGFFNVNIKNHDIVSCVEDITMSICGFAEKNKISITFDTEEEEKIIAFDL
NHLERILLNILSNAIKFNRENGNIDVYMSFDERYANISIKDTGIGIQKDKIDLLFHRFKK
INNRLTKVNEGSGIGLFIAKELVKINGGEMRVNSELGEGTEFIIKLPIKKIESEVLDEIA
LTSCERENREELYKVELSDIYSL
Download sequence
Identical sequences A0A0H2YUP0 A0A1U9V7D9
gi|110801193|ref|YP_695689.1| WP_011590627.1.10161 WP_011590627.1.20964 WP_011590627.1.30163 WP_011590627.1.50147 WP_011590627.1.52260 WP_011590627.1.5234 WP_011590627.1.52659 WP_011590627.1.68380 IDP04327 NYSGRC-FDAO-ABG84827 195103.CPF_1243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]