SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011600700.1.4002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011600700.1.4002
Domain Number 1 Region: 13-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 3.14e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011600700.1.4002
Sequence length 115
Comment PTS chitobiose transporter subunit IIA [Borreliella afzelii]; AA=GCF_000962775.1; RF=na; TAX=411555; STAX=29518; NAME=Borrelia afzelii K78; strain=K78; AL=Complete Genome; RT=Major
Sequence
MNKKIYSIEELVDKISMPVVAYSGEAKSFLREALEYAKNKDYEKAALTIQESKNSIAKAH
EAHREIIQQSATNPNSVKTPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences Q0SL50
gi|111074123|ref|YP_709251.1| gi|111074123|ref|YP_709251.1|NC_008274 gi|216997238|ref|YP_002333783.1|NC_011650 gi|384206197|ref|YP_005591972.1|NC_017229 390236.BAPKO_5004 gi|111074123|ref|YP_709251.1| WP_011600700.1.101990 WP_011600700.1.4002 WP_011600700.1.40725 WP_011600700.1.72423 WP_011600700.1.79404 WP_011600700.1.94617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]