SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011600938.1.79404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011600938.1.79404
Domain Number - Region: 6-103
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0811
Family DNA repair protein MutS, domain III 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011600938.1.79404
Sequence length 143
Comment flagellar protein FlbA [Borreliella afzelii]; AA=GCF_000165595.2; RF=na; TAX=390236; STAX=29518; NAME=Borrelia afzelii PKo; strain=PKo; AL=Chromosome; RT=Major
Sequence
MNDLNFRKQKLNRILTIRTYYRKLSERNLMNINKKISKINQFSDGIPNLLKSLNSFDDLS
IRGYIDCLNYKKKQNFKILGELRKHYNECYDIYVDKYREEKKIKILIKTLNNSIIKNREK
KESLLLDEYVNYKVCQDLRIESE
Download sequence
Identical sequences Q0SNM4
gi|111115112|ref|YP_709730.1| gi|111115112|ref|YP_709730.1| 390236.BAPKO_0297 WP_011600938.1.79404 WP_011600938.1.94617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]