SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011613536.1.43450 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011613536.1.43450
Domain Number 1 Region: 115-297
Classification Level Classification E-value
Superfamily E set domains 3.69e-57
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000124
Further Details:      
 
Domain Number 2 Region: 30-141
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.3e-22
Family Voltage-gated potassium channels 0.0000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011613536.1.43450
Sequence length 299
Comment K+ channel, inward rectifier, region 2 [Trichodesmium erythraeum]; AA=GCF_000014265.1; RF=representative genome; TAX=203124; STAX=1206; NAME=Trichodesmium erythraeum IMS101; strain=IMS101; AL=Complete Genome; RT=Major
Sequence
MKRNTTKKQKAFARKVGLMDFVIKGIPSFYWSDFYHWLMTISWRQLWVIIISFYFLINTI
FALLYLGSGDGIHNAKPGSFIDAFSFSIQTIATIGYGAMYPTNIYTHILVAIEVFIGLIG
IAMITGLMFARFSLPTARVLFSRIAVISPYDGVPTLMFRIANQRQNWIVEAEVKATVLLN
KEVSIEGHSLRKFGDLKLVRSETPMLSLTWLVMHQIDKDSPLYGWSEDDFKNINNQSIQL
FITLTGLDETVSQTIHARHVYRLDQILWHQRFVDLISTGIDGRFYLDYSLFHDVVPLQK
Download sequence
Identical sequences Q10X18
WP_011613536.1.43450 gi|113477618|ref|YP_723679.1| 203124.Tery_4204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]