SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011614425.1.2820 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011614425.1.2820
Domain Number 1 Region: 4-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 9.22e-101
Family Methylenetetrahydrofolate reductase 0.000000643
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011614425.1.2820
Sequence length 276
Comment methylenetetrahydrofolate reductase [NAD(P)H] [Cupriavidus necator]; AA=GCF_001598755.1; RF=na; TAX=1218105; STAX=106590; NAME=Cupriavidus necator NBRC 102504; strain=NBRC 102504; AL=Contig; RT=Major
Sequence
MQDRYFSFEFFPPKTAEGTEKLRNTRAQLAPLKPKYISVTFGAGGTTQQGTLDAVLEIQR
EGIEAAPHLSCVGSSRESIRAILQQYRDGGIRHIVALRGDMPSGMGEIGEFRYANELVEF
IRAETGDWFNIEVAAYPEYHPQAKSPRHDLENFVRKVKAGANSAITQYFYNADAYFRFVD
DVRATGLEVPIVPGIMPITNYTQLMRFSESCGAEVPRWVAKRLESFGDDRESIRAFGLDV
VTALCERLLAAGVPGLHFYTLNAAGATKAIWQRLKL
Download sequence
Identical sequences Q0KF23
gi|113866277|ref|YP_724766.1| WP_011614425.1.2820 WP_011614425.1.5264 WP_011614425.1.6206 WP_011614425.1.70127 381666.H16_A0246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]