SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011614425.1.6206 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011614425.1.6206
Domain Number 1 Region: 4-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 9.22e-101
Family Methylenetetrahydrofolate reductase 0.000000643
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011614425.1.6206
Sequence length 276
Comment methylenetetrahydrofolate reductase [NAD(P)H] [Cupriavidus necator]; AA=GCF_001481455.1; RF=na; TAX=106590; STAX=106590; NAME=Cupriavidus necator; strain=PHE3-6; AL=Contig; RT=Major
Sequence
MQDRYFSFEFFPPKTAEGTEKLRNTRAQLAPLKPKYISVTFGAGGTTQQGTLDAVLEIQR
EGIEAAPHLSCVGSSRESIRAILQQYRDGGIRHIVALRGDMPSGMGEIGEFRYANELVEF
IRAETGDWFNIEVAAYPEYHPQAKSPRHDLENFVRKVKAGANSAITQYFYNADAYFRFVD
DVRATGLEVPIVPGIMPITNYTQLMRFSESCGAEVPRWVAKRLESFGDDRESIRAFGLDV
VTALCERLLAAGVPGLHFYTLNAAGATKAIWQRLKL
Download sequence
Identical sequences Q0KF23
381666.H16_A0246 gi|113866277|ref|YP_724766.1| WP_011614425.1.2820 WP_011614425.1.5264 WP_011614425.1.6206 WP_011614425.1.70127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]