SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011618284.1.57161 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011618284.1.57161
Domain Number 1 Region: 51-149
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.71e-27
Family Pentapeptide repeats 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011618284.1.57161
Sequence length 157
Comment hypothetical protein [Synechococcus sp. CC9311]; AA=GCF_000014585.1; RF=na; TAX=64471; STAX=64471; NAME=Synechococcus sp. CC9311; strain=CC9311; AL=Complete Genome; RT=Major
Sequence
MTFLLKRIWCAFGSMALVLGPSAVEAGSVTAIAVEPFGTPLERLLESGACQGCDLRDADL
RGRHLIGADLRDADLRGAQLSGVNLEGADLSGARLDGARLQGAMLSNADLSDSDLRHADL
RDSVVINAYAPGVQTEGMQFAGSDLTGSHLIYGGGPD
Download sequence
Identical sequences Q0IDD3
64471.sync_0305 gi|113953553|ref|YP_729539.1| WP_011618284.1.57161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]