SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011622526.1.3791 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011622526.1.3791
Domain Number 1 Region: 446-538
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000175
Family Anti-sigma factor antagonist SpoIIaa 0.0095
Further Details:      
 
Weak hits

Sequence:  WP_011622526.1.3791
Domain Number - Region: 343-401
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0959
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011622526.1.3791
Sequence length 585
Comment sodium-independent anion transporter [Shewanella sp. MR-4]; AA=GCF_000014685.1; RF=na; TAX=60480; STAX=60480; NAME=Shewanella sp. MR-4; strain=MR-4; AL=Complete Genome; RT=Major
Sequence
MKFPSLVSLMPGLAQMLQYEKQWIRDDVRAGLSVAAVALPVAIAYAQLTGVNAAVGLYSC
VLPMLVYALFGTSRQLIVGPDAATCAVIAAVVTPLAAGDSMKHWQLVMTMTAMTGFWCLI
ASRFRLGVLADFLSKPILMGLLNGVAITIIVGQFSKIFGFTFDERYLIERLTGAPSYLTK
THWPTLLMGVVTLATYALVKRYRPLWPASMCAMAMAAFLVWAFNLTSFDINVVGEVSAGL
PSFQAPAFDLGIARELVVPALNLAMVSFVSMMLTARSFAAKNGYDIDADKEFRALGIANI
ASALSQGFAVSGADSRTAVNDANGGKSQLVSIIAAVLIALVALFFTAPLKYIPSSALGVV
LVIASISLIDLKALWNLRVRDRSAFLLACTTLFSVLFIGVIPGITLAVLLGLFQFLATVM
RPTDQVLGLDQKGVIRSVDDSGKAKSVPGVFIYRFNSPLTYFNATYFKRRLLEKFIREPE
PVDCIIIDAVPCFTHLDLSVMAMLADLHQLLKKRGIRLVLAGRKRQMLGWFEQAGMQSGE
GGILIRPDLYLALKMNQSYKQALAEGQAPVIKKAPEDDVLLHSHL
Download sequence
Identical sequences gi|113970093|ref|YP_733886.1| 60480.Shewmr4_1755 WP_011622526.1.3791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]