SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011629955.1.71132 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011629955.1.71132
Domain Number 1 Region: 11-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.28e-16
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011629955.1.71132
Sequence length 109
Comment anti-sigma factor antagonist [Alkalilimnicola ehrlichii]; AA=GCF_000014785.1; RF=representative genome; TAX=187272; STAX=351052; NAME=Alkalilimnicola ehrlichii MLHE-1; strain=MLHE-1; AL=Complete Genome; RT=Major
Sequence
MSRAGGKQAQLESTGEAGRFQLSGDLSFETVPGLWAEAERLFRGSGDVELDLGAVARTDS
AGLALLVALTRRAAQHDQAIRFCHFPEQLRAMARLSGLADFLQLAPEKA
Download sequence
Identical sequences Q0A6H6
2005452293 WP_011629955.1.71132 gi|114321368|ref|YP_743051.1| 187272.Mlg_2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]