SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011630818.1.65638 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011630818.1.65638
Domain Number 1 Region: 592-1042
Classification Level Classification E-value
Superfamily ALDH-like 3.01e-120
Family ALDH-like 0.000000436
Further Details:      
 
Domain Number 2 Region: 195-558
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.67e-108
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000000244
Further Details:      
 
Domain Number 3 Region: 26-193
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 8.89e-55
Family N-terminal domain of bifunctional PutA protein 0.00000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011630818.1.65638
Sequence length 1237
Comment bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase [Granulibacter bethesdensis]; AA=GCF_000014285.1; RF=representative genome; TAX=391165; STAX=364410; NAME=Granulibacter bethesdensis CGDNIH1; strain=CGDNIH1; AL=Complete Genome; RT=Major
Sequence
MIQHGGLAMTRSGLFIDLAQAFGTVTEARHRLDRACRHPEQDCVASLLPLASLSDHAASQ
ADTLARSLAERLREHGPGNGLSALIQEYDLSSQEGVALMCLAEALLRIPDDGTRDALIRD
KIGRGEWHTHLGWTRPLFVNAATWSLVLTGRLVAPSSASTLGAALTRLIGRAGEPVIRHA
MDRVVRLLGTRFVAGETIEAALAATSLLWTQGFRHSYDMLGEAAMTRADADRYYRAYEHA
IDCIGATLRARGYEPAEDMTALLEAPSISIKLSALHPRYEHTQHARIMQDLPPLLRNLAA
MARANGIALTIDAEEADRLPLSLDVLAALCADPVVAGWNGIGLAVQAYQRRAPAVIENLI
DLARHHDRRLMIRLVKGAYWDSEIKRAQIDGLESFPVFTRKSYTDLSYVACARMLLEAPD
AVFPQFATHNARTVATIIAMAEEITGVSFNPGQYEFQCLHGMGETLYADVVRPDGLNRPC
RIYAPVGNHETLLAYLVRRLLENGANTSFVNRVADTAISIDQLIADPVQQILAMRTECGV
PHPKIRSPRSLYGPERENAWGIDLTDATRMAQLAEACITLSSKRWLVSIEEDADRERISI
RNPAASWDHIGDVVFATAEEADRAIARARQAAPSWAAEPPSRRAACLRDAADAMERDVAL
FINLAVREAGKTIPNAIGEVREAVDFLRYYAAGIENGWNAQTHPPLGVVTCISPWNFPLA
IFTGQVAAALAAGNAVLAKPAEETPLIAAEAVAVLHRAGVPTAVLQLVPGDGAVGARLVA
DSRVNGVVFTGSTEAARFIQRSLSYRLNTHGDPVPLIAETGGQNAMIVDSTALPEQVVSD
VLVSAFDSAGQRCSALRVLCLQDDIADLVITMLRGALQERVTARPDRLDTDIGPVISAAA
RDAIEDHIAAMARAGCTMHRAALRQETEDGFFVAPTIIELGSHPIPDKEVFGPVLHVLRF
RRDDLSDVIARINATGYALTFGIHSRIQETVDHARMKSTAGNIYVNRSMIGAVVGVQPFG
GHGLSGTGPKAGGPLYLSRLVEHEPLSPVKQFFIEKEKNAVPASIKIWQVWIQQQGIEPL
SLPILRYDRDMVLPGPVGEQNIYRLSPRSSLLCIASDLERLSYLVQSALAAGIKHIAVSI
PADITYVFNTLPDALRSTVVLAAPDQEDSADTVLFEGDDAALIALQTRLAHQSGRIVPVY
RIRRRGRDIPLLALVAECTISINTAAAGGNAALMAMA
Download sequence
Identical sequences Q0BVZ4
391165.GbCGDNIH1_0110 WP_011630818.1.65638 WP_011630818.1.72603 WP_011630818.1.90404 gi|114326774|ref|YP_743931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]