SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011636590.1.15765 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011636590.1.15765
Domain Number 1 Region: 265-326
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000000036
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0071
Further Details:      
 
Domain Number 2 Region: 15-208
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 0.0000000000942
Family Dihydropteroate synthetase 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011636590.1.15765
Sequence length 371
Comment 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) [Shewanella frigidimarina]; AA=GCF_000014705.1; RF=representative genome; TAX=318167; STAX=56812; NAME=Shewanella frigidimarina NCIMB 400; strain=NCIMB 400; AL=Complete Genome; RT=Major
Sequence
MYNESPIIRRPSTRIYVGNVPIGDGAPIAVQSMTNTKTTDVAATVAQIRALEKVGADIVR
VSVPTMDDAEAFKIIKQSVNVPLVADIHFDYRIALKVAEYGADCLRINPGNIGNEERIRS
VVECARDKNIPIRIGVNGGSLEKDLMDKYREPTPEALFESAMRHVDILDRLNFDQFKVSV
KASDVFLAVASYRLLAKQIRQPLHLGITEAGGMRAGSVKSAVGLGMLLAEGIGDTLRISL
AADPVEEIKVGFDILKSLRIRSRGINFIACPSCSRQEFDVISTVNELERRLEDITTAMDV
SIIGCVVNGPGEALVSDIGLTGGHAKSGYYDDGVRQKERFDNNKIIDGLEAKIRAKASMM
ANRIAITDKTE
Download sequence
Identical sequences A0A106BWG7 Q085U6
318167.Sfri_1116 WP_011636590.1.15765 WP_011636590.1.45693 gi|114562294|ref|YP_749807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]