SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011638631.1.15765 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011638631.1.15765
Domain Number 1 Region: 140-336
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-56
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000433
Further Details:      
 
Domain Number 2 Region: 423-554
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.63e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000241
Further Details:      
 
Domain Number 3 Region: 9-139
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.39e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0011
Further Details:      
 
Domain Number 4 Region: 338-413
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.91e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011638631.1.15765
Sequence length 563
Comment assimilatory sulfite reductase (NADPH) hemoprotein subunit [Shewanella frigidimarina]; AA=GCF_000014705.1; RF=representative genome; TAX=318167; STAX=56812; NAME=Shewanella frigidimarina NCIMB 400; strain=NCIMB 400; AL=Complete Genome; RT=Major
Sequence
MSEQKLALNEYLKIDSDYLRGDIQEGLDTQVTGSFSDGDQQLIKFHGFYQQDDRDLRNER
KEQKLEPLHSFMLRARVPGGICTPAQWLEVDKISSTLTTSNSIRLTTRQTFQYHGIPKRN
LKTLIQGLDRAALDSIAACGDVNRNVMCNPNPVESKLHAQAYAVAKHLSDHLLPHTRAYA
EIWLDEEKLLGTETVEPVYGKTYLPRKFKMAVAVPPHNDVDVYTNDLGFIAVSEAGELIG
FNLVAGGGMGSTHGEVETFPRLADDFGFIKTDDVTKFAEAVMTVQRDWGNRVVRKRARLK
YTIVDHGYDAFKAEVEKRAGVKFEPKRDVIIGDRGDRYGWVEGIDNKFHLTLFIESGRIK
DMPGQTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAQDKAEIEGLARKHGLLGQVLSGT
RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGISEQSIVVRMTGCPNGCARPF
AAEIGLVGKAPGRYNLYLGASFEGTRLNKMHKENIQEAEILAELDTLFGRYATERDAGET
FGNFTVRIGVVKAVNDAAKDFHA
Download sequence
Identical sequences Q07Y86
gi|114564353|ref|YP_751867.1| WP_011638631.1.15765 318167.Sfri_3192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]