SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011655698.1.34573 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011655698.1.34573
Domain Number 1 Region: 5-274
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.18e-100
Family Methylenetetrahydrofolate reductase 0.000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011655698.1.34573
Sequence length 276
Comment methylenetetrahydrofolate reductase [NAD(P)H] [Burkholderia ambifaria]; AA=GCF_000959545.1; RF=na; TAX=339670; STAX=152480; NAME=Burkholderia ambifaria AMMD; strain=AMMD; AL=Complete Genome; RT=Major
Sequence
MKPIELSFEFFPPKTAEGVEKLRATRAQLLPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
DGLEAAPHLSCIGSSRADLRAILDQYRSHGIRHIVALRGDLPSGMGAVGELRYASELVSF
IRAEHGDWFHIEVAGYPEYHPQARSPKADLENFARKVKAGANSAITQYFFNADAYFRFVD
DARKLGVDVPIVPGIMPITNFTQLMRFSEMCGAEVPRWVARRLESFGDDRDAIRAFGADV
VTSLCQRLVDAGVPGLHFYTLNTASATRTICERLAM
Download sequence
Identical sequences Q0BJC4
gi|115350244|ref|YP_772083.1| 339670.Bamb_0188 WP_011655698.1.34573 WP_011655698.1.59090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]