SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011667573.1.80197 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011667573.1.80197
Domain Number 1 Region: 5-293
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.12e-56
Family Lambda integrase-like, catalytic core 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011667573.1.80197
Sequence length 311
Comment tyrosine recombinase XerC [Lactobacillus brevis]; AA=GCF_001541605.1; RF=na; TAX=1580; STAX=1580; NAME=Lactobacillus brevis; strain=D6; AL=Contig; RT=Major
Sequence
MDRAITAFMTYLSGERQYSAETVKAYHEDLSEFVQFLADNGGEKPWTAIDQLDVEVYLSD
LYDRHYARTTIARKLSTLRSLYSFLMSNGQAQDDPFAYVQLKRHQNHLPRFFYEREMTAL
FTAAAANPNEQLATRDTALLEVLYGTGIRVSECVNLALSEIDFDGRIMLIHGKGNKERYV
PFGHYASDALQTYFDTARTPLMAQYQQDHPYVFINHRGQQLTSAGVTYLLNQIIKRSTLT
TDIHPHMLRHTFATHLLNRGADLRSVQELLGHSSLSTTQIYTHVTREHLQRDYRQFFPRA
TSEHTSSKETD
Download sequence
Identical sequences A0A0C1MD18 Q03S80
387344.LVIS_0799 WP_011667573.1.1001 WP_011667573.1.101817 WP_011667573.1.10245 WP_011667573.1.12110 WP_011667573.1.14555 WP_011667573.1.30569 WP_011667573.1.33510 WP_011667573.1.34389 WP_011667573.1.35844 WP_011667573.1.47372 WP_011667573.1.49372 WP_011667573.1.51823 WP_011667573.1.57633 WP_011667573.1.61846 WP_011667573.1.68109 WP_011667573.1.78399 WP_011667573.1.79023 WP_011667573.1.80197 WP_011667573.1.85477 WP_011667573.1.92695 gi|116333446|ref|YP_794973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]