SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011667907.1.80197 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011667907.1.80197
Domain Number 1 Region: 1-241
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.54e-44
Family YhfI-like 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011667907.1.80197
Sequence length 246
Comment hypothetical protein [Lactobacillus brevis]; AA=GCF_001541605.1; RF=na; TAX=1580; STAX=1580; NAME=Lactobacillus brevis; strain=D6; AL=Contig; RT=Major
Sequence
MQLRVLGCYGGYPHNGVGTSSYLLTSGDFHLLLDCGSGALLALEKVLDPLQLNAVLLTHY
HHDHTADVGVLQYEWQLGSTQRSQAELPIYGHTADPLNFGALTWPHATIGRPYDPTQPIQ
IGPFTITFLATHHPVPAYAPRITETATGATLAFTADTAAFSGLTTWATGADVLLADTNFF
ADHQGTAWHLTSTQAGKLAQQAGVSRLLLTHLPQVGDLQQLKAEAQSAAGTGTRVEVVQA
GSIYNT
Download sequence
Identical sequences Q03R95
gi|116333781|ref|YP_795308.1| 387344.LVIS_1149 WP_011667907.1.1001 WP_011667907.1.10245 WP_011667907.1.30569 WP_011667907.1.33510 WP_011667907.1.61846 WP_011667907.1.80197 WP_011667907.1.92695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]